PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_23450V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 492aa    MW: 54573.9 Da    PI: 5.8483
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_23450V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+ Ed++lv +++ +G g+W++ +   g+ R++k+c++rw +yl
  Pp3c7_23450V3.1.p 16 KGPWTPNEDQKLVAYIQNHGHGSWRSLPLNAGLQRCGKSCRLRWTNYL 63
                       79********************************************97 PP

2Myb_DNA-binding54.92e-1769114148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rgr++++Ed+ ++++++ lG++ W++Ia++++ +Rt++++k++w+++l
  Pp3c7_23450V3.1.p  69 RGRFSQDEDQMIIHLHAILGNR-WSAIASHLP-RRTDNEIKNYWNTHL 114
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-231066IPR009057Homeodomain-like
PROSITE profilePS5129415.2171163IPR017930Myb domain
SuperFamilySSF466898.24E-3013110IPR009057Homeodomain-like
SMARTSM007172.0E-101565IPR001005SANT/Myb domain
PfamPF002495.3E-141663IPR001005SANT/Myb domain
CDDcd001671.01E-81863No hitNo description
PROSITE profilePS5129426.88364118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-2767118IPR009057Homeodomain-like
SMARTSM007171.0E-1768116IPR001005SANT/Myb domain
PfamPF002498.0E-1669114IPR001005SANT/Myb domain
CDDcd001674.52E-1371114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MTRPPSCDAK QEGLKKGPWT PNEDQKLVAY IQNHGHGSWR SLPLNAGLQR CGKSCRLRWT  60
NYLRPDIKRG RFSQDEDQMI IHLHAILGNR WSAIASHLPR RTDNEIKNYW NTHLKKRLLQ  120
IGIDPVSHES TTAEETMLDN IITGLRPVVS SSLTHMSQWD CARAEAEARL SRQSSLTSST  180
SELTQTSHQH QPLNLSTESN VNYQDESTNF MSSWKDLVTE TLRPNFGEVE LDKTPANPVD  240
LRKFLQDWES SLQAPQSLPE SYSADNSPID VPDVASGTAS EVASPPYSPN DLEGFCRIPG  300
SSPIFPSPAQ LTERLMASRH CNSLLLPPRT GLEGSNVFPT LQMTRNSQSL PAVGSSFNFS  360
GLCGADTEHQ FSPTSTLYNP DDSSYCSPCG NSDGISDSFN PLAQRFLLIH DNDQLPRANL  420
VTHFPSEQSL WSLQQVDMVG ALQPKPYFIS ELEVAASQKP RAPCFNASVS SMVNQVGLLN  480
DIPIPHFEFL C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28141185108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001751220.11e-122predicted protein, partial
SwissprotP800741e-154MYB1_PHYPA; Myb-related protein Pp1 (Fragment)
TrEMBLA9RAV41e-122A9RAV4_PHYPA; Uncharacterized protein (Fragment)
STRINGPP1S2_60V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.18e-77myb domain protein 106